PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v3639490.1
Common NameMYB101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 349aa    MW: 39245.4 Da    PI: 6.641
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v3639490.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.44e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G g+W++ ++  g++R++k+c++rw +yl
  Lj3g3v3639490.1 15 KGPWTPEEDAILVDYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding58.31.8e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++l++++++ lG++ W++Ia +++ gRt++++k++w+++l
  Lj3g3v3639490.1  68 RGKFTEEEEQLIINLHAVLGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2251062IPR017930Myb domain
SuperFamilySSF466898.8E-3312109IPR009057Homeodomain-like
SMARTSM007171.6E-151464IPR001005SANT/Myb domain
PfamPF002492.0E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-251669IPR009057Homeodomain-like
CDDcd001674.60E-121762No hitNo description
PROSITE profilePS5129428.12763117IPR017930Myb domain
SMARTSM007171.9E-1767115IPR001005SANT/Myb domain
PfamPF002494.3E-1768113IPR001005SANT/Myb domain
CDDcd001673.46E-1370113No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2870117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MMGRTPCCDE IGLKKGPWTP EEDAILVDYI QKHGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FTEEEEQLII NLHAVLGNKW SAIAGHLPGR TDNEIKNFWN THLKKKLLQM  120
GLDPVTHRPR LDHLNLLSNL QQFLAATNMV TSFTNTLDSN AALRLQSDAT QLAKLQLLQN  180
ILQVLGTNPA SNLELLNQLG PSSSISDTFL HEALGLNQSK LQELYKSSIV FPSHQNLSNL  240
QTLEVPHHLQ QHYMNGSSTI NSCMQSRKVV DEQLDATNSS STIPLNSLPN LVSASPQCST  300
VKEMENKVNP NECSNPSSTS TTFEMWGDFM CEEVNDDYWK DLIDQESNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30131175108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1086480.0AB108648.1 Lotus japonicus MYB101 gene for transcription factor MYB101, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592013.21e-180PREDICTED: transcription factor MYB39
TrEMBLQ84PP50.0Q84PP5_LOTJA; Transcription factor MYB101
STRINGGLYMA12G01960.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-108myb domain protein 9